Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

RUNX2 Antikörper (Middle Region)

RUNX2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN3043428
  • Target Alle RUNX2 Antikörper anzeigen
    RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
    Bindungsspezifität
    • 23
    • 16
    • 9
    • 7
    • 7
    • 7
    • 7
    • 5
    • 5
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 244-278, Middle Region
    Reaktivität
    • 142
    • 71
    • 44
    • 10
    • 8
    • 8
    • 8
    • 7
    • 7
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Human
    Wirt
    • 131
    • 14
    Kaninchen
    Klonalität
    • 123
    • 22
    Polyklonal
    Konjugat
    • 64
    • 11
    • 8
    • 6
    • 6
    • 6
    • 6
    • 6
    • 6
    • 6
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Dieser RUNX2 Antikörper ist unkonjugiert
    Applikation
    • 96
    • 49
    • 31
    • 26
    • 13
    • 11
    • 9
    • 7
    • 4
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Verwendungszweck
    Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
    Sequenz
    DRLSDLGRIP HPSMRVGVPP QNPRPSLNSA PSPFN
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
    Gene Name: runt-related transcription factor 2
    Protein Name: Runt-related transcription factor 2
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
    Isotyp
    IgG
    Top Product
    Discover our top product RUNX2 Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for RUNX2 is approximately 0.25 ng/lane under reducing conditions.
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handhabung
    Avoid repeated freezing and thawing.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Yao, Zhao, Ou, Liang, Lin, Wang: "MicroRNA-214 Suppresses Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting ATF4." in: Stem cells international, Vol. 2017, pp. 3028647, (2017) (PubMed).

    Wang, Wang, Dai, Chen, Yang, Dai, Ou, Wang, Lin: "Effects of Intermittent Administration of Parathyroid Hormone (1-34) on Bone Differentiation in Stromal Precursor Antigen-1 Positive Human Periodontal Ligament Stem Cells." in: Stem cells international, Vol. 2016, pp. 4027542, (2016) (PubMed).

    Li, Chen, Peng, Zhou, Fang: "Pulsed electromagnetic fields protect the balance between adipogenesis and osteogenesis on steroid-induced osteonecrosis of femoral head at the pre-collapse stage in rats." in: Bioelectromagnetics, Vol. 35, Issue 3, pp. 170-80, (2014) (PubMed).

    Song, Yu, Zhao, Wei, Liu, Hu, Zhao, Yang, Wu: "The time-dependent manner of sinusoidal electromagnetic fields on rat bone marrow mesenchymal stem cells proliferation, differentiation, and mineralization." in: Cell biochemistry and biophysics, Vol. 69, Issue 1, pp. 47-54, (2014) (PubMed).

    Mu, Lv, Wang, Ma, Ma, Liu, Yu, Mu: "Mechanical stress stimulates the osteo/odontoblastic differentiation of human stem cells from apical papilla via erk 1/2 and JNK MAPK pathways." in: BioMed research international, Vol. 2014, pp. 494378, (2014) (PubMed).

    Shan, Zhou, Yang, Yan, Zhang, Fu, Jiang: "Lithium chloride promotes the odontoblast differentiation of hair follicle neural crest cells by activating Wnt/?-catenin signaling." in: Cell biology international, (2014) (PubMed).

    Xue, Wu, Zhou, Ma, Wang, Liu, Ma, Li: "IGF1 promotes osteogenic differentiation of mesenchymal stem cells derived from rat bone marrow by increasing TAZ expression." in: Biochemical and biophysical research communications, Vol. 433, Issue 2, pp. 226-31, (2013) (PubMed).

    Wang, Mu, Fan, Yu, Yan, Lei, Tang, Wang, Zheng, Yu, Zhang: "Insulin-like growth factor 1 can promote the osteogenic differentiation and osteogenesis of stem cells from apical papilla." in: Stem cell research, Vol. 8, Issue 3, pp. 346-56, (2012) (PubMed).

    Liu, Zhong, Liang, Fu, Luo, Zhou, Gou, Huang: "Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbfα-1 pathway." in: Journal of Zhejiang University. Science. B, Vol. 11, Issue 12, pp. 905-11, (2010) (PubMed).

  • Target
    RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
    Andere Bezeichnung
    RUNX2 (RUNX2 Produkte)
    Synonyme
    AML3 antikoerper, CBF-alpha-1 antikoerper, CBFA1 antikoerper, CCD antikoerper, CCD1 antikoerper, CLCD antikoerper, OSF-2 antikoerper, OSF2 antikoerper, PEA2aA antikoerper, PEBP2aA antikoerper, Cbf antikoerper, Cbfa-1 antikoerper, Cbfa1 antikoerper, LS3 antikoerper, Osf2 antikoerper, Pebp2a1 antikoerper, Pebpa2a antikoerper, runx2 antikoerper, RUNX2 antikoerper, ccd antikoerper, aml3 antikoerper, ccd1 antikoerper, osf2 antikoerper, cbfa1 antikoerper, pea2aa antikoerper, pebp2a1 antikoerper, pebp2a2 antikoerper, pebp2aa antikoerper, pebp2aa1 antikoerper, runt related transcription factor 2 antikoerper, runt-related transcription factor 2a antikoerper, runt-related transcription factor 2 antikoerper, runt related transcription factor 2 L homeolog antikoerper, RUNX2 antikoerper, runx2a antikoerper, Runx2 antikoerper, runx2 antikoerper, LOC703331 antikoerper, LOC100549663 antikoerper, runx2.L antikoerper
    Hintergrund
    Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.

    Synonyms: Acute myeloid leukemia 3 protein antibody|Alpha subunit 1 antibody|AML3 antibody|CBF alpha 1 antibody|CBF-alpha-1 antibody|CBFA1 antibody|CCD antibody|CCD1 antibody|Cleidocranial dysplasia 1 antibody|Core binding factor antibody|Core binding factor runt domain alpha subunit 1 antibody|Core binding factor subunit alpha 1 antibody|Core-binding factor subunit alpha-1 antibody|MGC120022 antibody|MGC120023 antibody|Oncogene AML 3 antibody|Oncogene AML-3 antibody|OSF 2 antibody|OSF-2 antibody|OSF2 antibody|Osteoblast specific transcription factor 2 antibody|Osteoblast-specific transcription factor 2 antibody|OTTHUMP00000016533 antibody|PEA2 alpha A antibody|PEA2-alpha A antibody|PEA2aA antibody|PEBP2 alpha A antibody|PEBP2-alpha A antibody|PEBP2A1 antibody|PEBP2A2 antibody|PEBP2aA antibody|PEBP2aA antibody|PEBP2aA1 antibody|Polyomavirus enhancer binding protein 2 alpha A subunit antibody|Polyomavirus enhancer-binding protein 2 alpha A subunit antibody|Runt domain antibody|Runt related transcription factor 2 antibody|Runt-related transcription factor 2 antibody|RUNX2 antibody|RUNX2_HUMAN antibody|SL3 3 enhancer factor 1 alpha A subunit antibody|SL3-3 enhancer factor 1 alpha A subunit antibody|SL3/AKV core binding factor alpha A subunit antibody|SL3/AKV core-binding factor alpha A subunit antibody
    Gen-ID
    860
    UniProt
    Q13950
Sie sind hier:
Kundenservice