STXBP1 Antikörper (N-Term)
-
- Target Alle STXBP1 Antikörper anzeigen
- STXBP1 (Syntaxin Binding Protein 1 (STXBP1))
-
Bindungsspezifität
- AA 184-216, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STXBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- KEYPAVRYRG EYKDNALLAQ LIQDKLDAYK ADD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 1
Protein Name: Syntaxin-binding protein 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product STXBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- STXBP1 (Syntaxin Binding Protein 1 (STXBP1))
- Andere Bezeichnung
- STXBP1 (STXBP1 Produkte)
- Synonyme
- MUNC18-1 antikoerper, NSEC1 antikoerper, P67 antikoerper, RBSEC1 antikoerper, UNC18 antikoerper, AI317162 antikoerper, AI326233 antikoerper, MMS10-G antikoerper, Ms10g antikoerper, Munc-18a antikoerper, Munc18-1 antikoerper, N-sec1 antikoerper, Rb-sec1 antikoerper, Sxtbp1 antikoerper, Unc18-1 antikoerper, Unc18h antikoerper, nsec1 antikoerper, fj43h10 antikoerper, stxbp1 antikoerper, wu:fj36d12 antikoerper, wu:fj43h10 antikoerper, zgc:114171 antikoerper, rop antikoerper, unc18 antikoerper, hunc18 antikoerper, rbsec1 antikoerper, munc18-1 antikoerper, MGC146482 antikoerper, ANC18HA antikoerper, NSEC1A antikoerper, Sec1 antikoerper, n-sec1 antikoerper, nSec1 antikoerper, rbSec1 antikoerper, rbSec1A antikoerper, rbSec1B antikoerper, UNC18A antikoerper, si:rp71-10d23.3 antikoerper, syntaxin binding protein 1 antikoerper, syntaxin binding protein 1a antikoerper, syntaxin binding protein 1 L homeolog antikoerper, syntaxin binding protein 1b antikoerper, STXBP1 antikoerper, Stxbp1 antikoerper, stxbp1a antikoerper, stxbp1 antikoerper, Tb09.160.0780 antikoerper, stxbp1.L antikoerper, stxbp1b antikoerper
- Hintergrund
-
Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.
Synonyms: FLJ37475 antibody|Munc 18 1 antibody|Munc 18a antibody|MUNC18 1 antibody|N-Sec1 antibody|Neuronal SEC1 antibody|NSec1 antibody|p67 antibody|Protein unc-18 homolog 1 antibody|Protein unc-18 homolog A antibody|Rb sec1 antibody|RBSEC1 antibody|STXB1_HUMAN antibody| STXBP1 antibody|Syntaxin binding protein 1 antibody|Syntaxin-binding protein 1 antibody|Unc 18 homolog antibody|Unc 18A antibody|Unc-18A antibody|Unc18 1 antibody|UNC18 antibody|Unc18-1 antibody - Gen-ID
- 6812
- UniProt
- P61764
- Pathways
- Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport
-