LIMK2 Antikörper (C-Term)
-
- Target Alle LIMK2 Antikörper anzeigen
- LIMK2 (LIM Domain Kinase 2 (LIMK2))
-
Bindungsspezifität
- AA 596-635, C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LIMK2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human,Mouse.
- Sequenz
- KLEDSFEALS LYLGELGIPL PAELEELDHT VSMQYGLTRD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human,Mouse.
Gene Name: LIM domain kinase 2
Protein Name: LIM domain kinase 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2 (596-635aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product LIMK2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- LIMK2 (LIM Domain Kinase 2 (LIMK2))
- Andere Bezeichnung
- LIMK2 (LIMK2 Produkte)
- Synonyme
- xlimk2 antikoerper, zgc:91990 antikoerper, wu:fa97c09 antikoerper, wu:fk73e11 antikoerper, LIMK2 antikoerper, Limk2b antikoerper, Link2 antikoerper, LIMK antikoerper, 9430059K01 antikoerper, A930024P04Rik antikoerper, C85310 antikoerper, Limk2a antikoerper, LIM domain kinase 2 L homeolog antikoerper, LIM domain kinase 2 antikoerper, LIM motif-containing protein kinase 2 antikoerper, limk2.L antikoerper, limk2 antikoerper, LIMK2 antikoerper, Limk2 antikoerper
- Hintergrund
-
LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.
Synonyms: LIM domain kinase 2 antibody|LIMK 2 antibody|LIMK-2 antibody|Limk2 antibody|LIMK2_HUMAN antibody - Gen-ID
- 3985
- UniProt
- P53671
-