SMC3 Antikörper (C-Term)

Produktnummer ABIN3043343

Produktdetails anti-SMC3 Antikörper

Target: SMC3 (Structural Maintenance of Chromosomes 3 (SMC3))

Bindungsspezifität: AA 1178-1216, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: ELLESADKFY GVKFRNKVSH IDVITAEMAK DFVEDDTTH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: structural maintenance of chromosomes 3
Protein Name: Structural maintenance of chromosomes protein 3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SMC3

Target: SMC3 (Structural Maintenance of Chromosomes 3 (SMC3))

Andere Bezeichnung: SMC3 (SMC3 Produkte)

Synonyme: cspg6 antikoerper, xsmc3 antikoerper, BAM antikoerper, BMH antikoerper, CDLS3 antikoerper, CSPG6 antikoerper, HCAP antikoerper, SMC3L1 antikoerper, Bamacan antikoerper, Cspg6 antikoerper, Mmip1 antikoerper, SMC-3 antikoerper, SmcD antikoerper, im:7142991 antikoerper, wu:fb22e01 antikoerper, wu:fc30d07 antikoerper, bamacan antikoerper, structural maintenance of chromosomes 3 antikoerper, structural maintenance of chromosomes 3 S homeolog antikoerper, smc3 antikoerper, SMC3 antikoerper, Smc3 antikoerper, smc3.S antikoerper

Hintergrund: Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Synonyms: BAM antibody|Bamacan antibody|Basement membrane associated chondroitin proteoglycan antibody|Basement membrane-associated chondroitin proteoglycan antibody|BMH antibody|CDLS3 antibody|chondroitin sulfate proteoglycan 6 (bamacan) antibody|Chondroitin sulfate proteoglycan 6 antibody|Chromosome associated polypeptide antibody|Chromosome-associated polypeptide antibody|CSPG 6 antibody|CSPG6 antibody|hCAP antibody|SMC 3 antibody|SMC protein 3 antibody|SMC-3 antibody|smc3 antibody|SMC3_HUMAN antibody|SMC3L1 antibody| Structural maintenance of chromosome 3 antibody|Structural maintenance of chromosomes 3 antibody|Structural maintenance of chromosomes protein 3 antibody

Gen-ID: 9126

Pathways: Stem Cell Maintenance