STXBP2 Antikörper (N-Term)

Produktnummer ABIN3043304

Produktdetails anti-STXBP2 Antikörper

Target: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Bindungsspezifität: AA 184-215, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STXBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: QEYPAIRYRK GPEDTAQLAH AVLAKLNAFK AD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 2
Protein Name: Syntaxin-binding protein 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu STXBP2

Target: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Andere Bezeichnung: STXBP2 (STXBP2 Produkte)

Synonyme: zgc:85807 antikoerper, FHL5 antikoerper, Hunc18b antikoerper, MUNC18-2 antikoerper, UNC18-2 antikoerper, UNC18B antikoerper, pp10122 antikoerper, C79054 antikoerper, Munc-18-2 antikoerper, Munc-18b antikoerper, Munc18b antikoerper, Sxtbp2 antikoerper, Sxtp2 antikoerper, Unc18-2 antikoerper, Unc18b antikoerper, muSec1 antikoerper, MUNC-18-2 antikoerper, syntaxin binding protein 2 antikoerper, stxbp2 antikoerper, STXBP2 antikoerper, Stxbp2 antikoerper

Hintergrund: Syntaxin-binding protein 2, also known as UNC18B, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Synonyms: FHL5 antibody|Hunc18b antibody|MUNC18 2 antibody|pp10122 antibody|Protein unc-18 homolog 2 antibody|Protein unc-18 homolog B antibody| STXB2_HUMAN antibody|Stxbp2 antibody|syntaxin binding protein 2 antibody|Syntaxin-binding protein 2 antibody|Unc-18B antibody|UNC18 2 antibody|Unc18-2 antibody|UNC18B antibody

Gen-ID: 6813

UniProt: Q15833

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis