DGAT1 Antikörper (Middle Region)

Produktnummer ABIN3043266

Produktdetails anti-DGAT1 Antikörper

Target: DGAT1 (Diacylglycerol O-Acyltransferase 1 (DGAT1))

Bindungsspezifität: AA 280-318, Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human,Rat.

Sequenz: RRILEMLFFT QLQVGLIQQW MVPTIQNSMK PFKDMDYSR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human,Rat.
Gene Name: diacylglycerol O-acyltransferase 1
Protein Name: Diacylglycerol O-acyltransferase 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu DGAT1

Target: DGAT1 (Diacylglycerol O-Acyltransferase 1 (DGAT1))

Andere Bezeichnung: DGAT1 (DGAT1 Produkte)

Synonyme: ARAT antikoerper, ARGP1 antikoerper, DGAT antikoerper, C75990 antikoerper, D15Ertd23e antikoerper, Dgat antikoerper, dgat1 antikoerper, wu:fd36g11 antikoerper, zgc:77691 antikoerper, DGAT1 antikoerper, ABX45 antikoerper, AS11 antikoerper, ATDGAT antikoerper, DIACYLGLYCEROL ACYLTRANSFERASE antikoerper, F27F23.24 antikoerper, RDS1 antikoerper, TRIACYLGLYCEROL BIOSYNTHESIS DEFECT 1 antikoerper, DDBDRAFT_0202877 antikoerper, DDBDRAFT_0304727 antikoerper, DDB_0202877 antikoerper, DDB_0304727 antikoerper, zgc:92327 antikoerper, diacylglycerol O-acyltransferase 1 antikoerper, diacylglycerol O-acyltransferase 1a antikoerper, diacylglycerol O-acyltransferase 1 L homeolog antikoerper, membrane bound O-acyl transferase (MBOAT) family protein antikoerper, diacylglycerol O-acyltransferase Dga1 antikoerper, diacylglycerol O-acyltransferase 1b antikoerper, DGAT1 antikoerper, Dgat1 antikoerper, dgat1a antikoerper, dgat1.L antikoerper, TAG1 antikoerper, dgat1 antikoerper, MGYG_02131 antikoerper, Tsp_02502 antikoerper, LOC100283803 antikoerper, dga1 antikoerper, dgat1b antikoerper

Hintergrund: Acyl-CoA: diacylglycerol acyltransferase (DGAT) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics.

Synonyms: ACAT related gene product 1 antibody|ACAT-related gene product 1 antibody|Acyl coenzyme A:cholesterol acyltransferase related gene 1 antibody|Acyl-CoA retinol O-fatty-acyltransferase antibody|Acyl-CoA:diacylglycerol acyltransferase antibody|ARAT antibody| ARGP1 antibody|C75990 antibody|D15Ertd23e antibody|Dgat antibody|DGAT1 antibody|DGAT1_HUMAN antibody|Diacylglycerol O acyltransferase 1 antibody|Diacylglycerol O-acyltransferase 1 antibody|DIAR7 antibody|Diglyceride acyltransferase antibody|EC 2.3.1.20 antibody| hCG_24006 antibody|MGC139064 antibody|Retinol O fatty acyltransferase antibody

Gen-ID: 8694

UniProt: O75907

Pathways: Hormone Transport