CRY1 Antikörper (N-Term)
-
- Target Alle CRY1 Antikörper anzeigen
- CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))
-
Bindungsspezifität
- AA 153-189, N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRY1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
- Sequenz
- FQTLISKMEP LEIPVETITS EVIEKCTTPL SDDHDEK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
Gene Name: cryptochrome circadian clock 1
Protein Name: Cryptochrome-1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product CRY1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))
- Andere Bezeichnung
- CRY1 (CRY1 Produkte)
- Synonyme
- cry1-A antikoerper, CRY1 antikoerper, cry2 antikoerper, phll1 antikoerper, xCRY1 antikoerper, PHLL1 antikoerper, AU020726 antikoerper, AU021000 antikoerper, Phll1 antikoerper, ATCRY1 antikoerper, BLU1 antikoerper, BLUE LIGHT UNINHIBITED 1 antikoerper, CRYPTOCHROME 1 APOPROTEIN (BLUE LIGHT PHOTORECEPTOR antikoerper, ELONGATED HYPOCOTYL 4 antikoerper, HY4 antikoerper, OOP2 antikoerper, OUT OF PHASE 2 antikoerper, T3H13.14 antikoerper, T3H13_14 antikoerper, cryptochrome 1 antikoerper, cryptochrome circadian clock 1 L homeolog antikoerper, cryptochrome circadian regulator 1 antikoerper, cryptochrome circadian clock 1 antikoerper, Cryptochrome-1 antikoerper, cryptochrome 1 antikoerper, cryptochrome 1 (photolyase-like) antikoerper, cry1.L antikoerper, CRY1 antikoerper, cry1 antikoerper, siu50817b antikoerper, Cry1 antikoerper
- Hintergrund
-
This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.
Synonyms: Cry1 antibody|CRY1_HUMAN antibody|Cryptochrome 1 (photolyase like) antibody|Cryptochrome 1 antibody|Cryptochrome-1 antibody|PHLL1 antibody|Photolyase 1 antibody|Photolyase-like antibody - Gen-ID
- 1407
- UniProt
- Q16526
- Pathways
- Response to Water Deprivation, Proton Transport
-