CRY1 Antikörper (N-Term)

Produktnummer ABIN3042761

Produktdetails anti-CRY1 Antikörper

Target: CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))

Bindungsspezifität: AA 153-189, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.

Sequenz: FQTLISKMEP LEIPVETITS EVIEKCTTPL SDDHDEK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
Gene Name: cryptochrome circadian clock 1
Protein Name: Cryptochrome-1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CRY1

Target: CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))

Andere Bezeichnung: CRY1 (CRY1 Produkte)

Hintergrund: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Synonyms: Cry1 antibody|CRY1_HUMAN antibody|Cryptochrome 1 (photolyase like) antibody|Cryptochrome 1 antibody|Cryptochrome-1 antibody|PHLL1 antibody|Photolyase 1 antibody|Photolyase-like antibody

Gen-ID: 1407

UniProt: Q16526

Pathways: Response to Water Deprivation, Proton Transport