HNF1B Antikörper (C-Term)
-
- Target Alle HNF1B Antikörper anzeigen
- HNF1B (HNF1 Homeobox B (HNF1B))
-
Bindungsspezifität
- AA 496-525, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNF1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human,Rat.
- Sequenz
- AQQPFMAAVT QLQNSHMYAH KQEPPQYSHT
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human,Rat.
Gene Name: HNF1 homeobox B
Protein Name: Hepatocyte nuclear factor 1-beta - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product HNF1B Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HNF1B (HNF1 Homeobox B (HNF1B))
- Andere Bezeichnung
- HNF1B (HNF1B Produkte)
- Synonyme
- FJHN antikoerper, HNF-1B antikoerper, HNF1beta antikoerper, HNF2 antikoerper, HPC11 antikoerper, LF-B3 antikoerper, LFB3 antikoerper, MODY5 antikoerper, TCF-2 antikoerper, TCF2 antikoerper, VHNF1 antikoerper, HNF-1b antikoerper, HNF1B antikoerper, AI385728 antikoerper, AI987804 antikoerper, HNF-1Beta antikoerper, Hnf1beta antikoerper, Tcf-2 antikoerper, Tcf2 antikoerper, vHNF1 antikoerper, vHNF-1 antikoerper, chunp6877 antikoerper, hnf1b antikoerper, mst antikoerper, tcf2 antikoerper, vhnf1 antikoerper, lfb3 antikoerper, hnf-1beta antikoerper, hnf1-beta antikoerper, hnf1beta antikoerper, HNF1g antikoerper, wu:fc23f06 antikoerper, HNF1 homeobox B antikoerper, HNF1 homeobox Ba antikoerper, HNF1 homeobox B S homeolog antikoerper, HNF1 homeobox B L homeolog antikoerper, HNF1 homeobox Bb antikoerper, HNF1B antikoerper, Hnf1b antikoerper, hnf1ba antikoerper, hnf1b.S antikoerper, hnf1b.L antikoerper, hnf1bb antikoerper
- Hintergrund
-
HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).
Synonyms: FJHN antibody|Hepatocyte nuclear factor 1 beta antibody|Hepatocyte nuclear factor 1-beta antibody|HNF 1B antibody|HNF 2 antibody|HNF-1-beta antibody|HNF-1B antibody|HNF1 beta antibody|HNF1 homeobox B antibody|HNF1B antibody|HNF1beta antibody|HNF2 antibody| Homeoprotein LF B3 antibody|Homeoprotein LFB3 antibody|HPC11 antibody|LF B3 antibody|LFB3 antibody|MODY 5 antibody|MODY5 antibody|TCF 2 antibody|TCF 2 protein antibody|TCF-2 antibody|TCF2 antibody|TCF2 protein antibody|Transcription factor 2 antibody|Transcription factor 2 hepatic antibody|Variant hepatic nuclear factor 1 antibody|Variant hepatic nuclear factor antibody|VHNF 1 antibody|vHNF1 antibody - Gen-ID
- 6928
- UniProt
- P35680
- Pathways
- Hormone Transport, Stem Cell Maintenance, Tube Formation
-