HHEX Antikörper (Middle Region)
-
- Target Alle HHEX Antikörper anzeigen
- HHEX (Hematopoietically Expressed Homeobox (HHEX))
-
Bindungsspezifität
- AA 146-180, Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HHEX Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human,Mouse, Rat.
- Sequenz
- NDQTIELEKK FETQKYLSPP ERKRLAKMLQ LSERQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human,Mouse, Rat.
Gene Name: hematopoietically expressed homeobox
Protein Name: Hematopoietically-expressed homeobox protein Hhex - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product HHEX Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HHEX (Hematopoietically Expressed Homeobox (HHEX))
- Andere Bezeichnung
- HHEX (HHEX Produkte)
- Synonyme
- hhex antikoerper, Hex antikoerper, prh antikoerper, XHex antikoerper, hmph antikoerper, prhx antikoerper, tHex antikoerper, hox11l-pen antikoerper, HHEX antikoerper, hex antikoerper, hhex-A antikoerper, HEX antikoerper, HMPH antikoerper, HOX11L-PEN antikoerper, PRH antikoerper, PRHX antikoerper, Hex1 antikoerper, Hhex-rs2 antikoerper, Prh antikoerper, Prhx antikoerper, PROBOX antikoerper, Homeobox protein PRH antikoerper, hematopoietically expressed homeobox antikoerper, hematopoietically expressed homeobox L homeolog antikoerper, Bm1_31285 antikoerper, hhex antikoerper, HHEX antikoerper, Hex1 antikoerper, hhex.L antikoerper, Hhex antikoerper
- Hintergrund
-
Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.'s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.
Synonyms: Hematopoietically expressed homeobox antibody|Hematopoietically-expressed homeobox protein HHEX antibody|HEX antibody|HHEX antibody| HHEX_HUMAN antibody|HMPH antibody|Homeobox hematopoietically expressed antibody|Homeobox protein HEX antibody|Homeobox protein PRH antibody|HOX11L PEN antibody|PRH antibody|PRHX antibody|Proline rich homeodomain containing transcription factor antibody| OTTHUMP00000206478 antibody|OTTHUMP00000206479 antibody|OTTHUMP00000206480 antibody|OTTHUMP00000206482 antibody|OTTHUMP00000207360 antibody|USURPIN antibody|Usurpin beta antibody - Gen-ID
- 3087
- UniProt
- Q03014
-