FMR1 Antikörper (N-Term)

Produktnummer ABIN3042398

Produktdetails anti-FMR1 Antikörper

Target: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Bindungsspezifität: AA 164-200, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FMR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Synaptic functional regulator FMR1(FMR1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: ENYQLVILSI NEVTSKRAHM LIDMHFRSLR TKLSLIM

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Synaptic functional regulator FMR1(FMR1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: fragile X mental retardation 1
Protein Name: Synaptic functional regulator FMR1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu FMR1

Target: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Andere Bezeichnung: FMR1 (FMR1 Produkte)

Synonyme: AT24755 antikoerper, BcDNA:GM08679 antikoerper, CG6203 antikoerper, Dmel\\CG6203 antikoerper, EP(3)3517 antikoerper, FMR antikoerper, FMR1 antikoerper, FMRP antikoerper, FMRp antikoerper, FXR antikoerper, Fmrp antikoerper, cg6203 antikoerper, dFMR antikoerper, dFMR1 antikoerper, dFMRP antikoerper, dFXR antikoerper, dFXR1 antikoerper, dFXRP antikoerper, dFmr1 antikoerper, dFmrp antikoerper, dfmr antikoerper, dfmr1 antikoerper, dfxr antikoerper, dfxr1 antikoerper, dmfr1 antikoerper, fmr antikoerper, fmr1 antikoerper, FRAXA antikoerper, POF antikoerper, POF1 antikoerper, zFMR1 antikoerper, Fmr-1 antikoerper, CG6203 gene product from transcript CG6203-RC antikoerper, fragile X mental retardation 1 antikoerper, fragile X mental retardation syndrome 1 antikoerper, Fmr1 antikoerper, FMR1 antikoerper, fmr1 antikoerper

Hintergrund: FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mentalretardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normal cognitive development and female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

Synonyms: FMR 1 antibody|Fmr1 antibody|Fmr1 gene antibody|FMR1_HUMAN antibody|FMRP antibody|Fragile X mental retardation 1 antibody|Fragile X mental retardation 1 protein antibody|Fragile X mental retardation protein 1 antibody|FRAXA antibody|MGC87458 antibody|POF antibody| POF1 antibody|Protein FMR-1 antibody|Protein FMR1 antibody

Gen-ID: 2332

UniProt: Q06787

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development