MGST1 Antikörper (N-Term)
-
- Target Alle MGST1 Antikörper anzeigen
- MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))
-
Bindungsspezifität
- AA 42-75, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MGST1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- KVFANPEDCV AFGKGENAKK YLRTDDRVER VRRA
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: microsomal glutathione S-transferase 1
Protein Name: Microsomal glutathione S-transferase 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human MGST1 (42-75aa KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product MGST1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))
- Andere Bezeichnung
- MGST1 (MGST1 Produkte)
- Synonyme
- gst12 antikoerper, mgst antikoerper, mgst-i antikoerper, zgc:101898 antikoerper, MGST1 antikoerper, GST12 antikoerper, MGST antikoerper, MGST-I antikoerper, 1500002K10Rik antikoerper, Gst antikoerper, microsomal glutathione S-transferase 1 L homeolog antikoerper, microsomal glutathione S-transferase 1.1 antikoerper, microsomal glutathione S-transferase 1 pseudogene antikoerper, microsomal glutathione S-transferase 1 antikoerper, mgst1.L antikoerper, mgst1.1 antikoerper, LOC473380 antikoerper, MGST1 antikoerper, mgst1 antikoerper, CpipJ_CPIJ015233 antikoerper, CpipJ_CPIJ018241 antikoerper, Mgst1 antikoerper
- Hintergrund
-
Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.
Synonyms: MGST1 antibody|Glutathione S transferase 12 antibody|GST12 antibody|MGST 1 antibody|MGST antibody|MGST1 antibody|MGST1_HUMAN antibody| Microsomal glutathione S-transferase 1 antibody|Microsomal GST 1 antibody|Microsomal GST-1 antibody|Microsomal GST-I antibody - Gen-ID
- 4257
- UniProt
- P10620
-