UCHL1 Antikörper (C-Term)

Produktnummer ABIN3042339

Produktdetails anti-UCHL1 Antikörper

Target: UCHL1 (Ubiquitin Carboxyl-terminal Esterase L1 (Ubiquitin Thiolesterase) (UCHL1))

Bindungsspezifität: AA 120-153, C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UCHL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: ETEKMSPEDR AKCFEKNEAI QAAHDAVAQE GQCR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin C-terminal hydrolase L1
Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-UCHL1 Antikörper (ABIN3042339)

Han, Chen, Huang, Zhu: "Nude mice multi-drug resistance model of orthotopic transplantation of liver neoplasm and Tc-99m MIBI SPECT on p-glycoprotein." in: World journal of gastroenterology, Vol. 11, Issue 22, pp. 3335-8, (2005) (PubMed).

Details zu UCHL1

Target: UCHL1 (Ubiquitin Carboxyl-terminal Esterase L1 (Ubiquitin Thiolesterase) (UCHL1))

Andere Bezeichnung: UCHL1 (UCHL1 Produkte)

Synonyme: PARK5 antikoerper, PGP 9.5 antikoerper, PGP9.5 antikoerper, PGP95 antikoerper, Uch-L1 antikoerper, UCH-L1 antikoerper, UCHL1 antikoerper, cb358 antikoerper, wu:fc55h08 antikoerper, park5 antikoerper, pgp9.5 antikoerper, uch-l1 antikoerper, MGC132191 antikoerper, uchl1 antikoerper, AW822034 antikoerper, C88048 antikoerper, R75593 antikoerper, UCHL-1 antikoerper, gad antikoerper, ubiquitin C-terminal hydrolase L1 antikoerper, ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) antikoerper, ubiquitin C-terminal hydrolase L1 L homeolog antikoerper, ubiquitin carboxyl-terminal esterase L1 antikoerper, ubiquitin carboxy-terminal hydrolase L1 antikoerper, UCHL1 antikoerper, uchl1 antikoerper, uchl1.L antikoerper, LOC100304750 antikoerper, Uchl1 antikoerper

Hintergrund: UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2 % of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Synonyms: Neuron cytoplasmic protein 9.5 antibody|OTTHUMP00000218137 antibody|OTTHUMP00000218139 antibody|OTTHUMP00000218140 antibody| OTTHUMP00000218141 antibody|Park 5 antibody|PARK5 antibody|PGP 9.5 antibody|PGP9.5 antibody|PGP95 antibody|Protein gene product 9.5 antibody|Ubiquitin C terminal esterase L1 antibody|Ubiquitin C terminal hydrolase antibody|Ubiquitin carboxyl terminal esterase L1 antibody|Ubiquitin carboxyl terminal hydrolase isozyme L1 antibody|Ubiquitin carboxyl-terminal hydrolase isozyme L1 antibody|Ubiquitin thioesterase L1 antibody|Ubiquitin thiolesterase antibody|Ubiquitin thiolesterase L1 antibody|UCH-L1 antibody|UCHL1 antibody| UCHL1_HUMAN antibody

Gen-ID: 7345

UniProt: P09936

Pathways: Feeding Behaviour