ZNF566 Antikörper (Middle Region)

Produktnummer ABIN2787529

Produktdetails anti-ZNF566 Antikörper

Target: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Bindungsspezifität: Middle Region

Reaktivität: Human, Rind (Kuh), Pferd, Ratte, Hund, Schwein, Kaninchen, Meerschweinchen, Maus, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZNF566 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Sequenz: YECKECGKAF SSGSNFTQHQ RIHTGEKPYE CKECGNAFSQ SSQLIKHQRI

Homologie: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%

Produktmerkmale: This is a rabbit polyclonal antibody against Zfp566. It was validated on Western Blot.

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Anwendungsinformationen

Applikationshinweise: Optimal working dilutions should be determined experimentally by the investigator.

Kommentare:

Antigen size: 386 AA

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freeze-thaw cycles.

Lagerung: -20 °C

Informationen zur Lagerung: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Details zu ZNF566

Target: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Andere Bezeichnung: Zfp566 (ZNF566 Produkte)

Synonyme: ZNF420 antikoerper, RGD1563239 antikoerper, zinc finger protein 566 antikoerper, ZNF566 antikoerper, Zfp566 antikoerper

Hintergrund: The function of this protein remains unknown.
Alias Symbols: RGD1563239
Protein Size: 386

Molekulargewicht: 45 kDa

Gen-ID: 502316

NCBI Accession: NM_001134726, NP_001128198

UniProt: B2RZ94