Surfactant Protein A1 Antikörper (AA 206-237)

Produktnummer ABIN2744324

Der Kaninchen Polyklonal Anti-Surfactant Protein A1-Antikörper wurde für WB, IHC und IHC (p) validiert. Er ist geeignet, Surfactant Protein A1 in Proben von Human, Ratte, Maus, Schimpanse und Orang-Utan zu detektieren.

Kurzübersicht für Surfactant Protein A1 Antikörper (AA 206-237) (ABIN2744324)

Target: Surfactant Protein A1 (SFTPA1)

Reaktivität: Human, Ratte, Maus, Schimpanse, Orang-Utan

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Surfactant Protein A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-Surfactant Protein A1 Antikörper

Bindungsspezifität: AA 206-237

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu Surfactant Protein A1

Target: Surfactant Protein A1 (SFTPA1)

Andere Bezeichnung: SFTPA1 + SFTPA2

Hintergrund: Name/Gene ID: SFTPA1

Synonyms: SFTPA1, Alveolar proteinosis protein, COLEC4, Collectin-4, PSP-A, PSPA, SFTP1, SFTPA, SFTPA1B, SPA1, SP-A, SP-A1, SPA, Surfactant Protein A, Surfactant protein A1, Surfactant protein A1B

Gen-ID: 653509