PIM1 Antikörper (AA 373-404)

Produktnummer ABIN2743635

Dieses Anti-PIM1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PIM1 in WB. Geeignet für Human, Pferd, Schaf, Affe, Schimpanse und Gibbon.

Kurzübersicht für PIM1 Antikörper (AA 373-404) (ABIN2743635)

Target: PIM1 (Pim-1 Oncogene (PIM1))

Reaktivität: Human, Pferd, Schaf, Affe, Schimpanse, Gibbon

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PIM1 Antikörper

Bindungsspezifität: AA 373-404

Spezifität: Expressed primarily in cells of the hematopoietic and germline lineages. Isoform 1 and isoform 2 are both expressed in prostate cancer cell lines. .

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu PIM1

Target: PIM1 (Pim-1 Oncogene (PIM1))

Andere Bezeichnung: PIM1 / Pim-1

Hintergrund: Name/Gene ID: PIM1
Subfamily: PIM
Family: Protein Kinase

Synonyms: PIM1, Pim-1 kinase 44 kDa isoform, Proviral integration site 1, Oncogene PIM1, PIM, Pim-1, Pim-1 oncogene

Gen-ID: 5292

Pathways: Glycosaminoglycan Metabolic Process