OTX2 Antikörper (AA 258-289)

Produktnummer ABIN2743418

Der Kaninchen Polyklonal Anti-OTX2-Antikörper wurde für WB validiert. Er ist geeignet, OTX2 in Proben von Human, Ratte, Maus, Hund, Schaf, Kaninchen, Pferd, Rind (Kuh), Fledermaus, Hamster, Schwein, Xenopus laevis, Huhn, Schimpanse, Gibbon, Affe und Orang-Utan zu detektieren.

Kurzübersicht für OTX2 Antikörper (AA 258-289) (ABIN2743418)

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Reaktivität: Human, Ratte, Maus, Hund, Schaf, Kaninchen, Pferd, Rind (Kuh), Fledermaus, Hamster, Schwein, Xenopus laevis, Huhn, Schimpanse, Gibbon, Affe, Orang-Utan

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OTX2 Antikörper

Bindungsspezifität: AA 258-289

Spezifität: Expressed in brain.

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu OTX2

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Andere Bezeichnung: OTX2

Hintergrund: Name/Gene ID: OTX2

Synonyms: OTX2, CPHD6, Homeobox protein OTX2, MCOPS5, Orthodenticle homeobox 2, Orthodenticle homolog 2

Gen-ID: 5015

Pathways: Dopaminergic Neurogenesis