NPY Antikörper (AA 29-64)

Produktnummer ABIN2743210

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NPY in WB, IHC und IHC (p). Er zeigt eine Reaktivität gegenüber Human, Ratte, Maus, Kaninchen, Hund, Meerschweinchen, Hamster, Affe und Schimpanse.

Kurzübersicht für NPY Antikörper (AA 29-64) (ABIN2743210)

Target: NPY (Neuropeptide Y (NPY))

Reaktivität: Human, Ratte, Maus, Kaninchen, Hund, Meerschweinchen, Hamster, Affe, Schimpanse

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NPY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-NPY Antikörper

Bindungsspezifität: AA 29-64

Spezifität: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu NPY

Target: NPY (Neuropeptide Y (NPY))

Andere Bezeichnung: Neuropeptide Y / NPY

Hintergrund: Name/Gene ID: NPY
Family: Pancreatic hormone

Synonyms: NPY, Pro-neuropeptide Y, Neuropeptide Y, PYY4

Gen-ID: 4852

Pathways: Feeding Behaviour