beta Defensin 1 Antikörper (AA 1-36)

Produktnummer ABIN234969

Dieser Anti-beta Defensin 1-Antikörper ist ein Maus-Monoklonal-Antikörper zum Nachweis von beta Defensin 1 in WB und ELISA. Geeignet für Human.

Kurzübersicht für beta Defensin 1 Antikörper (AA 1-36) (ABIN234969)

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser beta Defensin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA

Klon: M11-14b-D10

Produktdetails anti-beta Defensin 1 Antikörper

Bindungsspezifität: AA 1-36

Spezifität: Synthetic human beta-Defensin 1 (AA 1-36).

Produktmerkmale: MAb to beta-Defensin-1 (AA 1-36), Monoclonal antibody to Human Defensin beta-1 (AA 1-36), Cell culture

Aufreinigung: Protein G Chromatography. Cell culture

Immunogen: Synthetic human beta-Defensin 1 (AA 1-36). (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Suitable for use in ELISA and Western blot. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Reconstitute in 10 µL double distilled water.

Buffer: Lyophilized from 50 mM Tris, pH 7.4.

Konservierungsmittel: Without preservative

Handhabung: Avoid multiple freeze/thaw cycles.
Centrifuge product if not completely clear after standing at room temperature.
Prepare working dilution only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized product at 2-8 °C. After reconstitution, store at -28 °C.

Details zu beta Defensin 1

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Andere Bezeichnung: Defensin beta-1