Integrin alpha 3a Antikörper (Cytoplasmic Domain)

Produktnummer ABIN2295550

Dieser Maus Monoklonal Antikörper detektiert spezifisch Integrin alpha 3a in IHC, WB und IC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Integrin alpha 3a Antikörper (Cytoplasmic Domain) (ABIN2295550)

Target: Integrin alpha 3a

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3a Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Klon: 29A3

Produktdetails anti-Integrin alpha 3a Antikörper

Bindungsspezifität: Cytoplasmic Domain

Sequenz: CRTRALYEAK RQKAEMKSQP SETERLTDDY

Kreuzreaktivität: Human

Kreuzreaktivität (Details): Calculated cross reactivity: Hu

Produktmerkmale: Integrin alpha 3A

Aufreinigung: Purified by Protein G affinity chromatography.

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal working conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu Integrin alpha 3a

Target: Integrin alpha 3a