ANO1 Antikörper
-
- Target Alle ANO1 Antikörper anzeigen
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser ANO1 Antikörper ist unkonjugiert
-
Applikation
- Immunofluorescence (IF), Immunohistochemistry (IHC), Flow Cytometry (FACS), Western Blotting (WB), Immunoprecipitation (IP)
- Sequenz
- MSDFVDWVIP DIPKDISQQI HK-EKVLMVELFM REEQDKQQLL ETCMEKERQK DEPPCNHHNT KACPDSLGSP APSHAYHGGV L
- Kreuzreaktivität
- Human
- Kreuzreaktivität (Details)
- Calculated cross reactivity: Hu
- Produktmerkmale
- DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A)
- Aufreinigung
- Purified by Protein A/G affinity chromatography.
- Immunogen
- A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein. Cellular Localization: Cell Surface and Cytoplasmic
- Klon
- DOG-1-1
- Isotyp
- IgG1 kappa
- Top Product
- Discover our top product ANO1 Primärantikörper
-
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (AA 20-239) antibody
ANO1 Reaktivität: Maus IHC, WB, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (AA 1-151) antibodyANO1 Reaktivität: Human IF, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (AA 151-250) antibodyANO1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (AA 2-101) antibodyANO1 Reaktivität: Human IHC, StM Wirt: Maus Monoclonal DG1-1484 unconjugated
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (AA 2-101) antibodyANO1 Reaktivität: Human IHC Wirt: Maus Monoclonal MSVA-201M unconjugated
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (Middle Region) antibodyANO1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (AA 2-101) antibodyANO1 Reaktivität: Human IHC, StM Wirt: Kaninchen Monoclonal DG1-2564R unconjugated Recombinant Antibody
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) antibodyANO1 Reaktivität: Human IHC, StM Wirt: Maus Monoclonal rDG1-447 unconjugated Recombinant Antibody
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (Internal Region) antibodyANO1 Reaktivität: Human, Maus, Ratte IF, IHC, WB, ELISA, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 1, Calcium Activated Chloride Channel (ANO1) (AA 628-731) antibodyANO1 Reaktivität: Human IF, WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal working conditions should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- Supplied as a liquid in 10 mM PBS, 0.05 % BSA, 0.05 % sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- -20°C
-
- Target
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
- Andere Bezeichnung
- DOG-1 (ANO1 Produkte)
- Hintergrund
- Cellular Localization: Cell Surface and Cytoplasmic
-
