ITGA3 Antikörper (Cytoplasmic Domain)

Produktnummer ABIN201109

Dieses Maus Monoklonal-Antikörper erkennt spezifisch ITGA3 in WB, IHC, ICC und IHC (fro). Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ITGA3 Antikörper (Cytoplasmic Domain) (ABIN201109)

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ITGA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: 29A3

Produktdetails anti-ITGA3 Antikörper

Bindungsspezifität: Cytoplasmic Domain

Spezifität: Recognizes specifically the cytoplasmic domain of human integrin subunit a3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.

Aufreinigung: Protein G purified

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Type of Immunogen: Synthetic peptide - KLH conjugated

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Approved: ICC, IHC, IHC-Fr, WB

Usage: Immunohistochemistry (frozen): 1:100 - 1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent. Western Blot: 1:100 - 1:1000. Optimum dilutions to be determined by researcher.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS,  pH 7.2, 0.1 % sodium azide. No stabilizing proteins added.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeat freeze-thaw cycles.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Details zu ITGA3

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Andere Bezeichnung: ITGA3 / CD49c

Hintergrund: Name/Gene ID: ITGA3
Family: Integrin

Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18

Gen-ID: 3675

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex