Ataxin 1 Antikörper (AA 164-197)

Produktnummer ABIN1976879

Der Maus Monoklonal Anti-Ataxin 1-Antikörper wurde für WB, IHC und IP validiert. Er ist geeignet, Ataxin 1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Ataxin 1 Antikörper (AA 164-197) (ABIN1976879)

Target: Ataxin 1 (ATXN1)

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Ataxin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Klon: S76-8

Produktdetails anti-Ataxin 1 Antikörper

Bindungsspezifität: AA 164-197

Spezifität: Detects a 85 kD protein.

Aufreinigung: Protein G purified from tissue culture supernatant

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).

Type of Immunogen: Synthetic peptide

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Approved: IHC, IP, WB (1:1000)

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS,  pH 7.4, 0.1 % sodium azide, 50 % glycerol.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20°C.

Details zu Ataxin 1

Target: Ataxin 1 (ATXN1)

Andere Bezeichnung: ATXN1 / Ataxin-1 / SCA1

Hintergrund: Name/Gene ID: ATXN1

Synonyms: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1

Gen-ID: 6310

Pathways: Synaptic Membrane