beta Defensin 1 Antikörper (N-Term)

Produktnummer ABIN192005

Dieses Maus Monoklonal-Antikörper erkennt spezifisch beta Defensin 1 in WB und EIA. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für beta Defensin 1 Antikörper (N-Term) (ABIN192005)

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser beta Defensin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Enzyme Immunoassay (EIA)

Klon: M4-14b-H4 (M11-14b-H4)

Produktdetails anti-beta Defensin 1 Antikörper

Bindungsspezifität: AA 1-36, N-Term

Spezifität: This antibody detects Beta-Defensin 1 (aa 1-36). No cross reactivity obtainded with Human Beta-Defensin 3, Beta-Defensin 4, Beta-Defensin 12 and Beta-Defensin 16.

Produktmerkmale: Synonyms: Beta-defensin 1, BD1, BD-1, HBD1, hBD-1, DEFB1, DEFB101

Aufreinigung: Protein G Chromatography

Immunogen: Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges)AA Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: ELISA. Western blot.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS, pH 7.4

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Haltbarkeit: 12 months

Details zu beta Defensin 1

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Andere Bezeichnung: Defensin beta 1

Hintergrund: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. The mature form of Beta defensin 1 is 36 amino acids.Synonyms: BD-1, BD1, Beta-defensin 1, DEFB1, DEFB101, HBD1, hBD-1

Gen-ID: 1672

UniProt: P60022