PTH Antikörper (N-Term)
-
- Target Alle PTH Antikörper anzeigen
- PTH (Parathyroid Hormone (PTH))
-
Bindungsspezifität
- AA 1-38, N-Term
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser PTH Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)
- Spezifität
- This antibody detects Human PTH (aa 15-25, 1-34, 1-38, 1-84, 7-84). There was no cross-reactivity obtained with synthetic Human PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84), or with PTHrP (aa 1-86).
- Produktmerkmale
- Synonyms: Parathormone, Parathyrin
- Aufreinigung
- Affinity chromatography
- Immunogen
- Synthetic human PTH (aa 1-38) poly Lysin conjugatedAA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
- Klon
- B2-82
- Isotyp
- IgG1
- Top Product
- Discover our top product PTH Primärantikörper
-
anti-Parathyroid Hormone (PTH) antibody
PTH Reaktivität: Human WB, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Parathyroid Hormone (PTH) (AA 32-115) antibodyPTH Reaktivität: Human IHC, StM Wirt: Kaninchen Monoclonal PTH-2295R unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 1-34) antibodyPTH Reaktivität: Human IHC Wirt: Kaninchen Monoclonal MSVA-525R unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 32-115) antibodyPTH Reaktivität: Ratte IHC, WB, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Parathyroid Hormone (PTH) (AA 32-115) antibodyPTH Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Parathyroid Hormone (PTH) (Internal Region) antibodyPTH Reaktivität: Human ELISA, WB, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Parathyroid Hormone (PTH) (AA 1-115) antibodyPTH Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 2C7 unconjugated
anti-Parathyroid Hormone (PTH) (AA 1-34) antibodyPTH Reaktivität: Human IHC, StM Wirt: Kaninchen Monoclonal PTH-1717R unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 1-34) antibodyPTH Reaktivität: Human IHC, StM Wirt: Maus Monoclonal rPTH-911 unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 71-115) antibodyPTH Reaktivität: Human IHC, ELISA, IHC (p) Wirt: Ziege Polyclonal unconjugated
-
- Applikationshinweise
-
RIA (25 ng/mL). Immunohistochemistry (cryo sections and paraffin sections, 2 μg/mL). ELISA (1 μg/mL).
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user. - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Restore in aqua bidest to 1 mg/mL.
- Buffer
- 50 mM TRIS, pH 7.4, 0.05 % Sodium Azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch. - Haltbarkeit
- 12 months
-
- Target
- PTH (Parathyroid Hormone (PTH))
- Andere Bezeichnung
- Parathyroid Hormone / PTH (PTH Produkte)
- Synonyme
- PTH1 antikoerper, Pthp antikoerper, PTH-(1-84) antikoerper, Pth1 antikoerper, Pthr1 antikoerper, PTH antikoerper, parathyroid hormone antikoerper, parathyroid hormone S homeolog antikoerper, PTH antikoerper, Pth antikoerper, pth.S antikoerper
- Substanzklasse
- Hormone
- Hintergrund
- Synonyms: Parathormone, Parathyrin
- Gen-ID
- 5741
- UniProt
- P01270
- Pathways
- cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process
-
