PTH Antikörper (N-Term)

Produktnummer ABIN191957

Dieses Maus Monoklonal-Antikörper erkennt spezifisch PTH in IHC (p), RIA, IHC (fro) und EIA. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PTH Antikörper (N-Term) (ABIN191957)

Target: PTH (Parathyroid Hormone (PTH))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser PTH Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)

Klon: A1-64

Produktdetails anti-PTH Antikörper

Bindungsspezifität: AA 1-38, N-Term

Spezifität: This antibody detects PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1- 86).

Produktmerkmale: Synonyms: Parathormone, Parathyrin

Aufreinigung: Affinity chromatography

Immunogen: Synthetic human PTH (aa 1-38) poly Lysin conjugatedAA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: RIA (25 ng/mL). Immunohistochemistry (cryo-sections and paraffinsections, 2 μg/mL). ELISA (1 μg/mL).
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: 50 mM TRIS, pH 7.4, 0.05 % Sodium Azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch.

Haltbarkeit: 12 months

Details zu PTH

Target: PTH (Parathyroid Hormone (PTH))

Andere Bezeichnung: Parathyroid Hormone / PTH

Substanzklasse: Hormone

Hintergrund: Synonyms: Parathormone, Parathyrin

Gen-ID: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process