PTH Antikörper (N-Term)

Produktnummer ABIN191937

Dieses Anti-PTH-Antikörper ist ein Ratte Monoklonal-Antikörper zur Detektion von PTH in IHC (p), IHC (fro) und EIA. Geeignet für Human.

Kurzübersicht für PTH Antikörper (N-Term) (ABIN191937)

Target: PTH (Parathyroid Hormone (PTH))

Reaktivität: Human

Wirt: Ratte

Klonalität: Monoklonal

Konjugat: Dieser PTH Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)

Klon: 3B3

Produktdetails anti-PTH Antikörper

Bindungsspezifität: AA 1-34, N-Term

Spezifität: This antibody detects Human oxidized PTH (aa 1-34), native PTH in tissue sections and in circulation. Cross reacts with native PTH (aa 1-84).

Produktmerkmale: Synonyms: Parathormone, Parathyrin

Aufreinigung: Protein A Chromatography

Immunogen: Synthetic human PTH (aa 1-34) BSA conjugated. AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: ELISA. Immunohistochemistry (Cryo-Sections and Paraffin-Sections): 1/25-50.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS, pH 7.4 without preservatives

Konservierungsmittel: Without preservative

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store the antibody lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Haltbarkeit: 12 months

Details zu PTH

Target: PTH (Parathyroid Hormone (PTH))

Andere Bezeichnung: Parathyroid Hormone / PTH

Substanzklasse: Hormone

Hintergrund: Parathyroid hormone (PTH), or Parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration.Synonyms: Parathormone, Parathyrin

Gen-ID: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process