Ataxin 1 Antikörper (AA 164-197) (PE)
-
- Target Alle Ataxin 1 (ATXN1) Antikörper anzeigen
- Ataxin 1 (ATXN1)
-
Bindungsspezifität
- AA 164-197
-
Reaktivität
- Maus
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser Ataxin 1 Antikörper ist konjugiert mit PE
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Spezifität
- Detects ~85 kDa.
- Kreuzreaktivität
- Human, Maus, Ratte
- Aufreinigung
- Protein G Purified
- Immunogen
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
- Klon
- S76-8
- Isotyp
- IgG2b
- Top Product
- Discover our top product ATXN1 Primärantikörper
-
-
- Applikationshinweise
-
- WB (1:1000)
- ICC/IF (1:100)
- optimal dilutions for assays should be determined by the user.
- Kommentare
-
1 μg/ml of ABIN1741213 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- 1 mg/mL
- Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C
- Informationen zur Lagerung
- Conjugated antibodies should be stored at 4°C
-
- Target
- Ataxin 1 (ATXN1)
- Andere Bezeichnung
- Ataxin 1 (ATXN1 Produkte)
- Synonyme
- ATX1 antikoerper, D6S504E antikoerper, SCA1 antikoerper, ATXN1 antikoerper, ataxin 1b antikoerper, atxn1 antikoerper, 2900016G23Rik antikoerper, Atx1 antikoerper, C85907 antikoerper, ENSMUSG00000074917 antikoerper, Gm10786 antikoerper, Sca1 antikoerper, CG4547 antikoerper, Dmel\\CG4547 antikoerper, dAtx-1 antikoerper, dAtx1 antikoerper, sca1 antikoerper, ataxin 1 antikoerper, ataxin 1b antikoerper, Ataxin 1 antikoerper, ATXN1 antikoerper, atxn1b antikoerper, Atxn1 antikoerper, Atx-1 antikoerper
- Hintergrund
- Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
- Gen-ID
- 20238
- NCBI Accession
- NP_001186233
- UniProt
- P54254
- Pathways
- Synaptic Membrane
-