Ataxin 1 Antikörper (AA 164-197)
Kurzübersicht für Ataxin 1 Antikörper (AA 164-197) (ABIN1741197)
Target
Alle Ataxin 1 (ATXN1) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
Klon
-
-
Bindungsspezifität
- AA 164-197
-
Spezifität
- Detects ~85 kDa.
-
Kreuzreaktivität
- Human, Maus, Ratte
-
Aufreinigung
- Protein G Purified
-
Immunogen
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
-
Isotyp
- IgG2b
-
-
-
-
Applikationshinweise
-
- WB (1:1000)
- ICC/IF (1:100)
- optimal dilutions for assays should be determined by the user.
-
Kommentare
-
1 μg/ml of ABIN1741197 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Liquid
-
Konzentration
- 1 mg/mL
-
Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated
-
Konservierungsmittel
- Sodium azide
-
Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Lagerung
- -20 °C
-
Informationen zur Lagerung
- -20°C
-
-
- Ataxin 1 (ATXN1)
-
Andere Bezeichnung
- Ataxin 1
-
Hintergrund
- Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
-
Gen-ID
- 20238
-
NCBI Accession
- NP_001186233
-
UniProt
- P54254
-
Pathways
- Synaptic Membrane
Target
-