ZNF93 Antikörper

Produktnummer ABIN1449891

Dieses Anti-ZNF93-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ZNF93 in WB. Geeignet für Human, Rind (Kuh), Maus, Ratte, Zebrafisch (Danio rerio) und Xenopus laevis.

Kurzübersicht für ZNF93 Antikörper (ABIN1449891)

Target: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Reaktivität: Human, Rind (Kuh), Maus, Ratte, Zebrafisch (Danio rerio), Xenopus laevis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZNF93 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZNF93 Antikörper

Kreuzreaktivität (Details): Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine

Aufreinigung: Purified using peptide immunoaffinity column

Immunogen: A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Konzentration: 1.0 mg/mL after reconstitution

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Details zu ZNF93

Target: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Andere Bezeichnung: ZNF93

Hintergrund: ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34

Molekulargewicht: 71 kDa (620 aa)

Gen-ID: 81931

NCBI Accession: NP_112495