PKIB Antikörper (Protein Kinase (CAMP-Dependent, Catalytic) Inhibitor beta) (AA 2-54)

Details for Product anti-PKIB Antibody No. ABIN1327199
Antigen
Epitop
AA 2-54
4
3
2
1
1
1
1
Reaktivität
Human
17
9
8
2
2
2
2
1
1
1
Wirt
Maus
17
Klonalität (Klon)
Monoklonal ()
Konjugat
Dieser PKIB Antikörper ist unkonjugiert
1
1
1
Applikation
ELISA, Western Blotting (WB)
12
8
4
4
3
2
1
Optionen
Verwendungszweck Mouse monoclonal antibody raised against a partial recombinant PKIB.
Immunogen

immunogen: PKIB (NP_115860.1, 2 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: RTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSV

Klon 7F8
Isotyp IgG2a kappa
Kreuzreaktivität Human
Antigen
Andere Bezeichnung PKIB (PKIB Antibody Abstract)
Hintergrund Full Gene Name: protein kinase (cAMP-dependent, catalytic) inhibitor beta
Synonyms: FLJ23817,PRKACN2
Gen-ID 5570
NCBI Accession NP_115860, NM_032471
Pathways Myometrial Relaxation and Contraction
Applikations-hinweise Optimal working dilution should be determined by the investigator.
Kommentare

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Beschränkungen Nur für Forschungszwecke einsetzbar
Buffer In 1x PBS, pH 7.4
Handhabung Aliquot to avoid repeated freezing and thawing.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Protein Kinase (CAMP-Dependent, Catalytic) Inhibitor beta (PKIB) (AA 2-54) antibody (ABIN1327199) Detection limit for recombinant GST tagged PKIB is 0.3 ng/ml as a capture antibody.