Actin-Like 6B Antikörper (AA 39-114)

Produktnummer ABIN1304554

Dieser Maus Monoklonal Antikörper erkennt spezifisch Actin-Like 6B in WB, IHC, ELISA und ICC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Actin-Like 6B Antikörper (AA 39-114) (ABIN1304554)

Target: Actin-Like 6B (ACTL6B)

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Actin-Like 6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunocytochemistry (ICC)

Güteklasse: KO Validated

Klon: N332B-15

Produktdetails anti-Actin-Like 6B Antikörper

Bindungsspezifität: AA 39-114

Verwendungszweck: Anti-BAF53b Antibody

Sequenz: TTVGLLAAEE GGGLELEGDK EKKGKIFHID TNALHVPRDG AEVMSPLKNG MIEDWECFRA ILDHTYSKHV KSEPNL

Spezifität: No off-targets reported for BAF53a

Kreuzreaktivität: Maus

Produktmerkmale: Our Anti-BAF53b mouse monoclonal primary antibody is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, ELISA.

Aufreinigung: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.

Reinheit: Purified mAbs are >90 % specific antibody.

Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise:

Dilution Range: ICC: 1:500

Dilution Range: WB: 1:1000

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065 % Sodium Azide 7.4

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Haltbarkeit: 24 months

Details zu Actin-Like 6B

Target: Actin-Like 6B (ACTL6B)

Andere Bezeichnung: BAF53b

Hintergrund:

Synonyms: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

Description Logic: Our Anti-BAF53b mouse monoclonal primary antibody is produced from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, ELISA.

Gene Name Alternatives: ACTL6B ACTL6 BAF53B

Molekulargewicht: 53 kDa

UniProt: O94805