ITGA3 Antikörper (Isoform 3A, N-Term)

Produktnummer ABIN112369

Dieses Maus Monoklonal-Antikörper erkennt spezifisch ITGA3 in WB, IF und IHC (fro). Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für ITGA3 Antikörper (Isoform 3A, N-Term) (ABIN112369)

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Reaktivität: Human, Hund

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ITGA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: 158A3

Produktdetails anti-ITGA3 Antikörper

Bindungsspezifität: Isoform 3A, N-Term

Spezifität: This antibody Clone 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated Integrin subunit α3A. A broad species reactivity is expected because of the conserved nature of the epitope.

Aufreinigung: Purified

Immunogen: 158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise: 158A3 is suitable for Immunoblotting, Immunocytochemistry, Immunohistochemistry onfrozen sections. Recommended dilutions: 1/100-1/200 for Immunohistochemistry with avidin-biotinylatedhorseradish peroxidase complex (ABC) as detection reagent, and 1/100-1/1000 forImmunoblotting applications.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: 1.0 mg/mL

Buffer: PBS, 0.09 % Sodium Azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized (preferably in a desiccator) at 2-8 °C and reconstituted (in aliquots) at -20 °C.

Details zu ITGA3

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Andere Bezeichnung: CD49c / ITGA3

Hintergrund: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated a and b subunits. More than 18 a and 8 b subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits a3 and a6, two cytoplasmic variants, A and B, have been identified.Synonyms: CD49 antigen-like family member C, FRP-2, GAPB3, Galactoprotein B3, ITGA-3, ITGAG3, Integrin alpha-3, MSK18, VLA-3 alpha chain, VLA3

Gen-ID: 3675

NCBI Accession: NP_002195

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex