ITGA3 Antikörper (Isoform 3A, N-Term)

Produktnummer ABIN112368

Produktdetails anti-ITGA3 Antikörper

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Bindungsspezifität: Isoform 3A, N-Term

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ITGA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunofluorescence (IF)

Spezifität: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.

Aufreinigung: Purified

Immunogen: 29A3 is a mouse monoclonal IgG1, k antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Klon: 29A3

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: 29A3 is suitable for Immunoblotting, Immunocytochemistry and Immunohistochemistry onfrozen tissues. Recommended dilutions: 1/100-1/200 for Immunohistochemistry with avidin-biotinylatedhorseradish peroxidase complex (ABC) as detection reagent, and 1/100-1/1000 forImmunoblotting applications.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: 1.0 mg/mL

Buffer: PBS, 0.09 % Sodium Azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time, it does not show decline in activity after two weeks at 4°C.

Lagerung: -20 °C

Informationen zur Lagerung: Store lyophilized antibody at -20 °C. Aliquot the product after reconstitution to

Details zu ITGA3

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Andere Bezeichnung: CD49c / ITGA3 (ITGA3 Produkte)

Synonyme: CD49C antikoerper, GAP-B3 antikoerper, GAPB3 antikoerper, ILNEB antikoerper, MSK18 antikoerper, VCA-2 antikoerper, VL3A antikoerper, VLA3a antikoerper, ITGA3 antikoerper, AA407068 antikoerper, integrin subunit alpha 3 antikoerper, integrin subunit alpha 3 S homeolog antikoerper, integrin alpha 3 antikoerper, ITGA3 antikoerper, itga3.S antikoerper, Itga3 antikoerper

Hintergrund: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated a and b subunits. More than 18 a and 8 b subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits a3 and a6, two cytoplasmic variants, A and B, have been identified.Synonyms: CD49 antigen-like family member C, FRP-2, GAPB3, Galactoprotein B3, ITGA-3, ITGAG3, Integrin alpha-3, MSK18, VLA-3 alpha chain, VLA3

Gen-ID: 3675

NCBI Accession: NP_002195

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex