29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
Aufreinigung
Purified
Immunogen
29A3 is a mouse monoclonal IgG1, k antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
29A3 is suitable for Immunoblotting, Immunocytochemistry and Immunohistochemistry onfrozen tissues. Recommended dilutions: 1/100-1/200 for Immunohistochemistry with avidin-biotinylatedhorseradish peroxidase complex (ABC) as detection reagent, and 1/100-1/1000 forImmunoblotting applications. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Beschränkungen
Nur für Forschungszwecke einsetzbar
Konzentration
1.0 mg/mL
Buffer
PBS, 0.09 % Sodium Azide
Konservierungsmittel
Sodium azide
Vorsichtsmaßnahmen
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung
Avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time, it does not show decline in activity after two weeks at 4°C.
Lagerung
-20 °C
Informationen zur Lagerung
Store lyophilized antibody at -20 °C. Aliquot the product after reconstitution to
Target
ITGA3
(Integrin, alpha 3 (ITGA3))
Andere Bezeichnung
CD49c / ITGA3
Hintergrund
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated a and b subunits. More than 18 a and 8 b subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits a3 and a6, two cytoplasmic variants, A and B, have been identified.Synonyms: CD49 antigen-like family member C, FRP-2, GAPB3, Galactoprotein B3, ITGA-3, ITGAG3, Integrin alpha-3, MSK18, VLA-3 alpha chain, VLA3