ZNF76 Antikörper (Middle Region)

Produktnummer ABIN1109607

Produktdetails anti-ZNF76 Antikörper

Target: ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Schwein

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZNF76 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Sequenz: MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK

Kreuzreaktivität (Details): Species reactivity (expected):Mouse, Rat, Pig, Bovine, DogSpecies reactivity (tested):Human

Aufreinigung: Purified using peptide immunoaffinity column

Immunogen: The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the middle region of human ZNF76

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Details zu ZNF76

Target: ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))

Andere Bezeichnung: ZNF76 (ZNF76 Produkte)

Synonyme: 2810027J07 antikoerper, BC025615 antikoerper, Znf76 antikoerper, D6S229E antikoerper, ZNF523 antikoerper, Zfp523 antikoerper, zinc finger protein 523 antikoerper, zinc finger protein 76 antikoerper, Zfp523 antikoerper, ZNF76 antikoerper

Hintergrund: ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF76 may be involved in transcriptional regulation.Synonyms: D6S229E, ZNF523, Zinc finger protein 523, Zinc finger protein 76

Gen-ID: 7629

NCBI Accession: NP_003418