ZNF76 Antikörper (Middle Region)
-
- Target Alle ZNF76 Antikörper anzeigen
- ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund, Rind (Kuh), Schwein
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZNF76 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Sequenz
- MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK
- Kreuzreaktivität (Details)
- Species reactivity (expected):Mouse, Rat, Pig, Bovine, DogSpecies reactivity (tested):Human
- Aufreinigung
- Purified using peptide immunoaffinity column
- Immunogen
- The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the middle region of human ZNF76
- Top Product
- Discover our top product ZNF76 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))
- Andere Bezeichnung
- ZNF76 (ZNF76 Produkte)
- Hintergrund
- ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF76 may be involved in transcriptional regulation.Synonyms: D6S229E, ZNF523, Zinc finger protein 523, Zinc finger protein 76
- Gen-ID
- 7629
- NCBI Accession
- NP_003418
-