SNF8 Antikörper (N-Term)

Produktnummer ABIN1109459

Der Kaninchen Polyklonal Anti-SNF8-Antikörper wurde für WB und IHC (p) validiert. Er ist geeignet, SNF8 in Proben von Human, Ratte, Maus, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Xenopus laevis und Huhn zu detektieren.

Kurzübersicht für SNF8 Antikörper (N-Term) (ABIN1109459)

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Reaktivität: Human, Ratte, Maus, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Xenopus laevis, Huhn

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNF8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-SNF8 Antikörper

Bindungsspezifität: N-Term

Sequenz: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF

Kreuzreaktivität (Details): Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human

Aufreinigung: Purified on peptide immunoaffinity column

Immunogen: The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Add 50 μL of distilled water

Handhabung: Avoid repeated freezing and thawing.

Lagerung: -20 °C

Informationen zur Lagerung: Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.

Haltbarkeit: 12 months

Details zu SNF8

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Andere Bezeichnung: Vacuolar-Sorting Protein SNF8

Hintergrund: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22

Gen-ID: 11267

NCBI Accession: NP_009172