SNF8 Antikörper (N-Term)

Produktnummer ABIN1109459

Produktdetails anti-SNF8 Antikörper

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Xenopus laevis, Huhn

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNF8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Sequenz: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF

Kreuzreaktivität (Details): Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human

Aufreinigung: Purified on peptide immunoaffinity column

Immunogen: The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Add 50 μL of distilled water

Handhabung: Avoid repeated freezing and thawing.

Lagerung: -20 °C

Informationen zur Lagerung: Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.

Haltbarkeit: 12 months

Details zu SNF8

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Andere Bezeichnung: Vacuolar-Sorting Protein SNF8 (SNF8 Produkte)

Hintergrund: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22

Gen-ID: 11267

NCBI Accession: NP_009172