IVNS1ABP Antikörper (N-Term)

Produktnummer ABIN1107889

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IVNS1ABP in WB und IHC (p). Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Hund, Rind (Kuh), Zebrafisch (Danio rerio), Schwein und Xenopus laevis.

Kurzübersicht für IVNS1ABP Antikörper (N-Term) (ABIN1107889)

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Zebrafisch (Danio rerio), Schwein, Xenopus laevis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IVNS1ABP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-IVNS1ABP Antikörper

Bindungsspezifität: N-Term

Sequenz: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL

Kreuzreaktivität (Details): Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human

Aufreinigung: Purified using Protein A affinity column

Immunogen: The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Add 100 μL of distilled water to a final concentration of 1 mg/mL.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Details zu IVNS1ABP

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Andere Bezeichnung: IVNS1ABP

Substanzklasse: Influenza Protein

Hintergrund: This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP

Gen-ID: 10625

NCBI Accession: NP_006460

Pathways: Negative Regulation of intrinsic apoptotic Signaling