IVNS1ABP Antikörper (N-Term)

Produktnummer ABIN1107889

Produktdetails anti-IVNS1ABP Antikörper

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Zebrafisch (Danio rerio), Schwein, Xenopus laevis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IVNS1ABP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Sequenz: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL

Kreuzreaktivität (Details): Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human

Aufreinigung: Purified using Protein A affinity column

Immunogen: The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Add 100 μL of distilled water to a final concentration of 1 mg/mL.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Details zu IVNS1ABP

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Andere Bezeichnung: IVNS1ABP (IVNS1ABP Produkte)

Substanzklasse: Influenza Protein

Hintergrund: This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP

Gen-ID: 10625

NCBI Accession: NP_006460

Pathways: Negative Regulation of intrinsic apoptotic Signaling