PTH Antikörper (AA 1-38)

Produktnummer ABIN110065

Dieser Maus Monoklonal Antikörper detektiert spezifisch PTH in ELISA, RIA und IHC (fro). Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PTH Antikörper (AA 1-38) (ABIN110065)

Target: PTH (Parathyroid Hormone (PTH))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser PTH Antikörper ist unkonjugiert

Applikation: ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: A1-64

Produktdetails anti-PTH Antikörper

Bindungsspezifität: AA 1-38

Spezifität: Human PTH peptide (aa 15-25 1-34 1-38 1-84 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3 1-10 4-16 28-48 39-84 44-68 53-84), PTHrP (aa 1-86)

Aufreinigung: Purified

Immunogen: Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)

Anwendungsinformationen

Applikationshinweise: RIA (25 ng/ml) Immunohistochemistry (cryo-sections and paraffin-sections 2 microg/ml) ELISA (1 microg/ml)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Details zu PTH

Target: PTH (Parathyroid Hormone (PTH))

Andere Bezeichnung: Parathyroid Hormone

Substanzklasse: Hormone

Hintergrund: Cell culture supernatant, affinity purified, 50 mM TRIS pH 7,4 NaN3 0.05%

Gen-ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process