PTH Antikörper (AA 1-38)

Produktnummer ABIN110062

Dieses Anti-PTH-Antikörper ist ein Maus Monoklonal-Antikörper zur Detektion von PTH in ELISA, RIA und IHC (fro). Geeignet für Human.

Kurzübersicht für PTH Antikörper (AA 1-38) (ABIN110062)

Target: PTH (Parathyroid Hormone (PTH))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser PTH Antikörper ist unkonjugiert

Applikation: ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: A1-70

Produktdetails anti-PTH Antikörper

Bindungsspezifität: AA 1-38

Spezifität: Human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) and PTHrP (aa 1-86)

Aufreinigung: Purified

Immunogen: Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)

Anwendungsinformationen

Applikationshinweise: RIA (20 ng/ml) Immunohistochemistry (cryo-sections and paraffin sections 2 microg/ml) ELISA (1microg/ml)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Details zu PTH

Target: PTH (Parathyroid Hormone (PTH))

Andere Bezeichnung: Parathyroid Hormone

Substanzklasse: Hormone

Hintergrund: Cell supernatant, Prot. A purified 0,01 M sodiumphosphate, 0,15 M sodium chloride pH 7,2

Gen-ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process