PRO-ANP Antikörper (AA 1-30)

Produktnummer ABIN109956

Der Schaf Polyklonal Anti-PRO-ANP Antikörper wurde für ELISA und RIA validiert. Er ist geeignet, PRO-ANP in Proben von Human zu detektieren.

Kurzübersicht für PRO-ANP Antikörper (AA 1-30) (ABIN109956)

Target: PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))

Reaktivität: Human

Wirt: Schaf

Klonalität: Polyklonal

Konjugat: Dieser PRO-ANP Antikörper ist unkonjugiert

Applikation: ELISA, Radioimmunoassay (RIA)

Produktdetails anti-PRO-ANP Antikörper

Bindungsspezifität: AA 1-30

Spezifität: Synthetic human pro-ANP (aa 1-30) There were no cross reactivities obtained with human pro-ANP (aa 31-67, 67-98) and human ANP (aa 1-28)

Immunogen: Synthetic human pro-ANP (aa 1-30) poly Lysin conjugated (npmynavsnadlmdfknlldhleekmpled)

Anwendungsinformationen

Applikationshinweise: RIA (1/5000) ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Details zu PRO-ANP

Target: PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))

Andere Bezeichnung: Pro-Atrial Natriuretic Peptide

Hintergrund: Serum

Gen-ID: 4878