CGRP Antikörper

Produktnummer ABIN109808

Dieser Ziege Polyklonal Antikörper erkennt spezifisch CGRP in RIA. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CGRP Antikörper (ABIN109808)

Target: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser CGRP Antikörper ist unkonjugiert

Applikation: Radioimmunoassay (RIA)

Produktdetails anti-CGRP Antikörper

Spezifität: Human Calcitonin Gene-related Peptide There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin

Immunogen: Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf)

Anwendungsinformationen

Applikationshinweise: RIA (1/3,000)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Details zu CGRP

Target: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Andere Bezeichnung: Calcitonin-Gene related Peptide

Hintergrund: Serum

Gen-ID: 797

Pathways: Hormone Activity, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Skeletal Muscle Fiber Development, Feeding Behaviour