CGRP Antikörper
-
- Target Alle CGRP (CALCA) Antikörper anzeigen
- CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))
-
Reaktivität
- Human
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CGRP Antikörper ist unkonjugiert
-
Applikation
- Radioimmunoassay (RIA)
- Spezifität
- Human Calcitonin Gene-related Peptide There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin
- Immunogen
- Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf)
- Top Product
- Discover our top product CALCA Primärantikörper
-
-
- Applikationshinweise
- RIA (1/3,000)
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Resuspend in aqua bidest.
- Lagerung
- 4 °C
-
- Target
- CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))
- Andere Bezeichnung
- Calcitonin-Gene related Peptide (CALCA Produkte)
- Hintergrund
- Serum
- Gen-ID
- 797
- Pathways
- Hormone Activity, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Skeletal Muscle Fiber Development, Feeding Behaviour
-