PTH Antikörper (AA 1-34)

Produktnummer ABIN109748

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PTH in RIA. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PTH Antikörper (AA 1-34) (ABIN109748)

Target: PTH (Parathyroid Hormone (PTH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTH Antikörper ist unkonjugiert

Applikation: Radioimmunoassay (RIA)

Produktdetails anti-PTH Antikörper

Bindungsspezifität: AA 1-34

Spezifität: Human PTH (aa 1-34)

Aufreinigung: Purified

Immunogen: Synthetic human PTH (aa 1-34), bTG- conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnf)

Anwendungsinformationen

Applikationshinweise: RIA (1/10,000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Details zu PTH

Target: PTH (Parathyroid Hormone (PTH))

Andere Bezeichnung: Parathyroid Hormone

Substanzklasse: Hormone

Hintergrund: Serum

Gen-ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process