Parathyroid Hormone 2 (PTH2) Antikörper

Produktnummer ABIN109738

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in ELISA, IHC (p) und RIA. Geeignet für Human.

Kurzübersicht für Parathyroid Hormone 2 (PTH2) Antikörper (ABIN109738)

Target: Parathyroid Hormone 2 (PTH2)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA)

Produktdetails

Spezifität: Human, bovine, canis TIP 39

Immunogen: synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)

Anwendungsinformationen

Applikationshinweise: ELISA (1/4.000) RIA (1/ 2.000), Immunohistochemistry (paraffin section, 1:100) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Antigendetails

Target: Parathyroid Hormone 2 (PTH2)

Andere Bezeichnung: TIP 39

Hintergrund: Serum

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development