ACVR1C/ALK7 Antikörper (N-Term)

Produktnummer ABIN636054

Der Kaninchen Polyklonal anti-ACVR1C/ALK7 Antikörper (ABIN636054) detektiert spezifisch ACVR1C/ALK7 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ACVR1C/ALK7 Antikörper (N-Term) (ABIN636054)

Target: ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACVR1C/ALK7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACVR1C/ALK7 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACVR1 C antibody was raised against the N terminal of ACVR1

Aufreinigung: Affinity purified

Immunogen: ACVR1 C antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACVR1C Blocking Peptide, (ABIN5611928), is also available for use as a blocking control in assays to test for specificity of this ACVR1C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACVR1C/ALK7

Target: ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))

Andere Bezeichnung: ACVR1C

Hintergrund: ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Positive Regulation of Endopeptidase Activity