WNT5A Antikörper (Middle Region)

Produktnummer ABIN635529

Der Kaninchen Polyklonal anti-WNT5A Antikörper (ABIN635529) detektiert spezifisch WNT5A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für WNT5A Antikörper (Middle Region) (ABIN635529)

Target: WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WNT5A Antikörper

Bindungsspezifität: Middle Region

Spezifität: WNT5 A antibody was raised against the middle region of WNT5

Aufreinigung: Affinity purified

Immunogen: WNT5 A antibody was raised using the middle region of WNT5 corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT5A Blocking Peptide, (ABIN938660), is also available for use as a blocking control in assays to test for specificity of this WNT5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT5A

Target: WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))

Andere Bezeichnung: WNT5A

Hintergrund: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: WNT Signalweg, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Regulation of Cell Size, Tube Formation