SLC4A2 Antikörper (N-Term)

Produktnummer ABIN635346

Der Kaninchen Polyklonal anti-SLC4A2 Antikörper (ABIN635346) detektiert spezifisch SLC4A2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLC4A2 Antikörper (N-Term) (ABIN635346)

Target: SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC4A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC4A2 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLC4 A2 antibody was raised against the N terminal of SLC4 2

Aufreinigung: Affinity purified

Immunogen: SLC4 A2 antibody was raised using the N terminal of SLC4 2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC4A2 Blocking Peptide, (ABIN5616263), is also available for use as a blocking control in assays to test for specificity of this SLC4A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC4A2

Target: SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))

Andere Bezeichnung: SLC4A2

Hintergrund: SLC4A2 is a plasma membrane anion exchange protein of wide distribution.

Molekulargewicht: 137 kDa (MW of target protein)