ABCB1 Antikörper

Produktnummer ABIN635318

Der Kaninchen Polyklonal anti-ABCB1 Antikörper wird verwendet zum Nachweis von ABCB1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ABCB1 Antikörper (ABIN635318)

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABCB1 Antikörper

Aufreinigung: Affinity purified

Immunogen: ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCB1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ABCB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCB1

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Andere Bezeichnung: ABCB1

Hintergrund: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molekulargewicht: 141 kDa (MW of target protein)