ABCC3 Antikörper

Produktnummer ABIN635289

Der Kaninchen Polyklonal anti-ABCC3 Antikörper (ABIN635289) detektiert spezifisch ABCC3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ABCC3 Antikörper (ABIN635289)

Target: ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABCC3 Antikörper

Aufreinigung: Affinity purified

Immunogen: ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCC3 Blocking Peptide, (ABIN940093), is also available for use as a blocking control in assays to test for specificity of this ABCC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCC3

Target: ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))

Andere Bezeichnung: ABCC3

Hintergrund: ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined, however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.

Molekulargewicht: 168 kDa (MW of target protein)